PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2902s0249.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 300aa    MW: 34152.8 Da    PI: 7.0485
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2902s0249.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.7e-18101153456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Bostr.2902s0249.1.p 101 KKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 153
                          4568889*********************************************9 PP

2HD-ZIP_I/II128.92e-4199190192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekk+rl+ eqv++LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlE+dy++Lk+++d lk++n++L +++++L++e
  Bostr.2902s0249.1.p  99 EKKKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDVLKSDNDSLLSHNKKLHAE 188
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lk 92 
                          l 
  Bostr.2902s0249.1.p 189 LV 190
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.04E-1991157IPR009057Homeodomain-like
SMARTSM003892.6E-1798159IPR001356Homeobox domain
PROSITE profilePS5007116.55299155IPR001356Homeobox domain
CDDcd000863.01E-16100156No hitNo description
PfamPF000463.0E-15101153IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-19103163IPR009057Homeodomain-like
PRINTSPR000311.1E-5126135IPR000047Helix-turn-helix motif
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5135151IPR000047Helix-turn-helix motif
PfamPF021836.8E-15155194IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MAFPQHGFMF QQLHEDNAHH LPSPTSLPSC PPHLFYGGGG GGGNYMMNRS MSFTGVSDHH  60
HHHHLTQKSP STTNNMNDQD QVGEEDNLSD DGSHMMLGEK KKRLNLEQVR ALEKSFELGN  120
KLEPERKMQL AKALGLQPRQ IAIWFQNRRA RWKTKQLERD YDSLKKQFDV LKSDNDSLLS  180
HNKKLHAELV ALKKHDGKES ANIKRELAEA SWSNNGSTEN NHNTNTSDIN HVSMIKDLFP  240
SSIRSATATT TSTHIDHQMV QEQDQGFCNM FNGIDETTSA SYWAWPDQQQ QHHNHHQFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147155RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293640.0AK229364.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL16-61-C06.
GenBankBT0440590.0BT044059.1 Arabidopsis thaliana unknown protein (At5g15150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568309.20.0homeobox-leucine zipper protein HAT7
SwissprotQ004660.0HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLB5RID50.0B5RID5_ARATH; At5g15150
STRINGAT5G15150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30952666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-163homeobox 3